HPA036187

CDS1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA036187
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA036187, RRID:AB_10601797
Product name
Anti-CDS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA036187
Antibody type
Polyclonal
Antigen
CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLP
PFLKAVLRQ
Storage
-20C
Provider Type Product Number
- No reagents -