HPA032114

FBXO7 antibody from Atlas Antibodies
Fbx, FBX7, PARK15
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA032114
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA032114, RRID:AB_10696202
Product name
Anti-FBXO7
Provider product page
Atlas Antibodies - HPA032114
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCS
DANDALIVLIHLLMLESGYIPQGTEAKALSMPEKW
KLSGVYK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -