H00001946-A01

EFNA5 antibody from Abnova Corporation
AF1, EPLG7, LERK7

Antibody data

Product number
H00001946-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001946-A01, RRID:AB_463425
Product name
EFNA5 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00001946-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant EFNA5.
Antigen sequence
FSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGR
RSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVEN
SLEPADDTVHESAEPSRGEN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -