Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010734 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010734, RRID:AB_1078452
- Product name
- Anti-CD1A
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFS
NEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPF
EIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNN
SWLPYPVAGNMAKHFCKVLNQNQHEND- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Human 6-sulfo LacNAc (slan) dendritic cells are a major population of dermal dendritic cells in steady state and inflammation
Up-Regulation of the Chemokine CCL18 by Macrophages Is a Potential Immunomodulatory Pathway in Cutaneous T-Cell Lymphoma
Günther C, Starke J, Zimmermann N, Schäkel K
Clinical and Experimental Dermatology 2012 March;37(2):169-176
Clinical and Experimental Dermatology 2012 March;37(2):169-176
Up-Regulation of the Chemokine CCL18 by Macrophages Is a Potential Immunomodulatory Pathway in Cutaneous T-Cell Lymphoma
Günther C, Zimmermann N, Berndt N, Großer M, Stein A, Koch A, Meurer M
The American Journal of Pathology 2011 September;179(3):1434-1442
The American Journal of Pathology 2011 September;179(3):1434-1442
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human skin and smooth muscle tissues using Anti-CD1A antibody. Corresponding CD1A RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows distinct positivity in Langerhans cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human smooth muscle shows low expression as expected.
- Sample type
- HUMAN