WH0009750M1

RIPOR2 antibody from MilliporeSigma / Merck KGaA
C6orf32, DIFF48, FAM65B, KIAA0386, MYONAP
ELISA
Recommended by provider

Antibody data

Product number
WH0009750M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0009750M1, RRID:AB_1840402
Product name
Monoclonal Anti-C6orf32 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0009750M1
Antibody type
Monoclonal
Antigen
C6orf32 (AAH01232, a.a. 1-424) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MLVGSQSFSPGGPNGIIRSQSFAGFSGLQERRSRC
NSFIENSSALKKPQAKLKKMHNLGHKNNNPPKEPQ
PKRVEEVYRALKNGLDEYLEVHQTELDKLTAQLKD
MKRNSRLGVLYDLDKQIKTIERYMRRLEFHISKVD
ELYEAYCIQRRLQDGASKMKQAFATSPASKAARES
LTEINRSFKEYTENMCTIEVELENLLGEFSIKMKG
LAGFARLCPGDQYEIFMKYGRQRWKLKGKIEVNGK
QSWDGEETVF (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -