H00054778-M05
antibody from Abnova Corporation
Targeting: RNF111
ARK, Arkadia, DKFZP761D081, FLJ38008
Antibody data
- Antibody Data
- Antigen structure
- References [9]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054778-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054778-M05, RRID:AB_581762
- Product name
- RNF111 monoclonal antibody (M05), clone 1C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RNF111.
- Antigen sequence
MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKG
ILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDD
SQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYV
QNC- Isotype
- IgG
- Antibody clone number
- 1C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SUMO and ubiquitin-dependent XPC exchange drives nucleotide excision repair.
RNF111-dependent neddylation activates DNA damage-induced ubiquitination.
Arkadia, a novel SUMO-targeted ubiquitin ligase involved in PML degradation.
RNF111/Arkadia is a SUMO-targeted ubiquitin ligase that facilitates the DNA damage response.
RB1CC1 protein positively regulates transforming growth factor-beta signaling through the modulation of Arkadia E3 ubiquitin ligase activity.
Efficient TGF-β/SMAD signaling in human melanoma cells associated with high c-SKI/SnoN expression.
Context-dependent regulation of the expression of c-Ski protein by Arkadia in human cancer cells.
Overexpression of SnoN/SkiL, amplified at the 3q26.2 locus, in ovarian cancers: a role in ovarian pathogenesis.
Arkadia activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation.
van Cuijk L, van Belle GJ, Turkyilmaz Y, Poulsen SL, Janssens RC, Theil AF, Sabatella M, Lans H, Mailand N, Houtsmuller AB, Vermeulen W, Marteijn JA
Nature communications 2015 Jul 7;6:7499
Nature communications 2015 Jul 7;6:7499
RNF111-dependent neddylation activates DNA damage-induced ubiquitination.
Ma T, Chen Y, Zhang F, Yang CY, Wang S, Yu X
Molecular cell 2013 Mar 7;49(5):897-907
Molecular cell 2013 Mar 7;49(5):897-907
Arkadia, a novel SUMO-targeted ubiquitin ligase involved in PML degradation.
Erker Y, Neyret-Kahn H, Seeler JS, Dejean A, Atfi A, Levy L
Molecular and cellular biology 2013 Jun;33(11):2163-77
Molecular and cellular biology 2013 Jun;33(11):2163-77
RNF111/Arkadia is a SUMO-targeted ubiquitin ligase that facilitates the DNA damage response.
Poulsen SL, Hansen RK, Wagner SA, van Cuijk L, van Belle GJ, Streicher W, Wikström M, Choudhary C, Houtsmuller AB, Marteijn JA, Bekker-Jensen S, Mailand N
The Journal of cell biology 2013 Jun 10;201(6):797-807
The Journal of cell biology 2013 Jun 10;201(6):797-807
RB1CC1 protein positively regulates transforming growth factor-beta signaling through the modulation of Arkadia E3 ubiquitin ligase activity.
Koinuma D, Shinozaki M, Nagano Y, Ikushima H, Horiguchi K, Goto K, Chano T, Saitoh M, Imamura T, Miyazono K, Miyazawa K
The Journal of biological chemistry 2011 Sep 16;286(37):32502-12
The Journal of biological chemistry 2011 Sep 16;286(37):32502-12
Efficient TGF-β/SMAD signaling in human melanoma cells associated with high c-SKI/SnoN expression.
Javelaud D, van Kempen L, Alexaki VI, Le Scolan E, Luo K, Mauviel A
Molecular cancer 2011 Jan 6;10(1):2
Molecular cancer 2011 Jan 6;10(1):2
Context-dependent regulation of the expression of c-Ski protein by Arkadia in human cancer cells.
Nagano Y, Koinuma D, Miyazawa K, Miyazono K
Journal of biochemistry 2010 Apr;147(4):545-54
Journal of biochemistry 2010 Apr;147(4):545-54
Overexpression of SnoN/SkiL, amplified at the 3q26.2 locus, in ovarian cancers: a role in ovarian pathogenesis.
Nanjundan M, Cheng KW, Zhang F, Lahad J, Kuo WL, Schmandt R, Smith-McCune K, Fishman D, Gray JW, Mills GB
Molecular oncology 2008 Aug;2(2):164-81
Molecular oncology 2008 Aug;2(2):164-81
Arkadia activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation.
Levy L, Howell M, Das D, Harkin S, Episkopou V, Hill CS
Molecular and cellular biology 2007 Sep;27(17):6068-83
Molecular and cellular biology 2007 Sep;27(17):6068-83
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RNF111 expression in transfected 293T cell line by RNF111 monoclonal antibody (M05), clone 1C4.Lane 1: RNF111 transfected lysate(107.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RNF111 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RNF111 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol