H00054778-M05

antibody from Abnova Corporation

Targeting: RNF111 ARK, Arkadia, DKFZP761D081, FLJ38008

Western blot (Supportive data in Antibodypedia)

ELISA (Supportive data in Antibodypedia)

Immunocytochemistry (Supportive data in Antibodypedia)

Antibody Data

Product number

H00054778-M05

Provider

Abnova Corporation

Proper citation

Abnova Corporation Cat#H00054778-M05, RRID:AB_581762

Product name

RNF111 monoclonal antibody (M05), clone 1C4

Antibody type

Monoclonal

Description

Mouse monoclonal antibody raised against a partial recombinant RNF111.

Antigen sequence

MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKG
ILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDD
SQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYV
QNC


Isotype

IgG

Antibody clone number

1C4

Storage

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

References

Submitted references

SUMO and ubiquitin-dependent XPC exchange drives nucleotide excision repair.

van Cuijk L, van Belle GJ, Turkyilmaz Y, Poulsen SL, Janssens RC, Theil AF, Sabatella M, Lans H, Mailand N, Houtsmuller AB, Vermeulen W, Marteijn JA
Nature communications 2015 Jul 7;6:7499

---

RNF111-dependent neddylation activates DNA damage-induced ubiquitination.

Ma T, Chen Y, Zhang F, Yang CY, Wang S, Yu X
Molecular cell 2013 Mar 7;49(5):897-907

---

Arkadia, a novel SUMO-targeted ubiquitin ligase involved in PML degradation.

Erker Y, Neyret-Kahn H, Seeler JS, Dejean A, Atfi A, Levy L
Molecular and cellular biology 2013 Jun;33(11):2163-77

---

RNF111/Arkadia is a SUMO-targeted ubiquitin ligase that facilitates the DNA damage response.

Poulsen SL, Hansen RK, Wagner SA, van Cuijk L, van Belle GJ, Streicher W, Wikström M, Choudhary C, Houtsmuller AB, Marteijn JA, Bekker-Jensen S, Mailand N
The Journal of cell biology 2013 Jun 10;201(6):797-807

---

RB1CC1 protein positively regulates transforming growth factor-beta signaling through the modulation of Arkadia E3 ubiquitin ligase activity.

Koinuma D, Shinozaki M, Nagano Y, Ikushima H, Horiguchi K, Goto K, Chano T, Saitoh M, Imamura T, Miyazono K, Miyazawa K
The Journal of biological chemistry 2011 Sep 16;286(37):32502-12

---

Efficient TGF-β/SMAD signaling in human melanoma cells associated with high c-SKI/SnoN expression.

Javelaud D, van Kempen L, Alexaki VI, Le Scolan E, Luo K, Mauviel A
Molecular cancer 2011 Jan 6;10(1):2

---

Context-dependent regulation of the expression of c-Ski protein by Arkadia in human cancer cells.

Nagano Y, Koinuma D, Miyazawa K, Miyazono K
Journal of biochemistry 2010 Apr;147(4):545-54

---

Overexpression of SnoN/SkiL, amplified at the 3q26.2 locus, in ovarian cancers: a role in ovarian pathogenesis.

Nanjundan M, Cheng KW, Zhang F, Lahad J, Kuo WL, Schmandt R, Smith-McCune K, Fishman D, Gray JW, Mills GB
Molecular oncology 2008 Aug;2(2):164-81

---

Arkadia activates Smad3/Smad4-dependent transcription by triggering signal-induced SnoN degradation.

Levy L, Howell M, Das D, Harkin S, Episkopou V, Hill CS
Molecular and cellular biology 2007 Sep;27(17):6068-83

Western blot

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

Western Blot analysis of RNF111 expression in transfected 293T cell line by RNF111 monoclonal antibody (M05), clone 1C4.Lane 1: RNF111 transfected lysate(107.8 KDa).Lane 2: Non-transfected lysate.

ELISA

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

Detection limit for recombinant GST tagged RNF111 is 0.03 ng/ml as a capture antibody.

Validation comment

Sandwich ELISA (Recombinant protein)

Protocol

Protocol

Immunocytochemistry

Supportive validation

Submitted by

Abnova Corporation (provider)

Main image

Experimental details

Immunofluorescence of monoclonal antibody to RNF111 on HeLa cell . [antibody concentration 10 ug/ml]

Validation comment

Immunofluorescence

Protocol

Protocol