WH0092483M1

LDHAL6B antibody from MilliporeSigma / Merck KGaA
LDH6B, LDHAL6, LDHL
ELISA
Recommended by provider

Antibody data

Product number
WH0092483M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0092483M1, RRID:AB_1842266
Product name
Monoclonal Anti-LDHAL6B antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0092483M1
Antibody type
Monoclonal
Antigen
LDHAL6B (NP_909122, a.a. 282-382) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
EVTATAYEIIKMKGYTSWAIGLSVADLTESILKNL
RRIHPVSTITKGLYGIDEEVFLSIPCILGENGITN
LIKIKLTPEEEAHLKKSAKTLWEIQNKLKL* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -