HPA053962

LDHAL6B antibody from Atlas Antibodies
LDH6B, LDHAL6, LDHL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA053962
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA053962, RRID:AB_2682324
Product name
Anti-LDHAL6B
Provider product page
Atlas Antibodies - HPA053962
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TVPVVRASQRVSSVGANFLCLGMALCPRQATRIPL
NGTWLFTPVSKMATVKSELIERFTSEKPV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -