HPA029125

antibody from Atlas Antibodies

Targeting: HSD17B13 SCDR9, SDR16C3

Antibody data

Submit

Validation data

Product number: HPA029125 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA029125, RRID:AB_10601580
Product name: Anti-HSD17B13
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NNAGTVYPADLLSTKDEEITKTFEVNILGHFWITK ALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSS KFAAVGFHRGLTSELQALGKTGIKTSCLCPVFVNT GFTKNPSTRLWPVLETDEVVRSLI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HSD17B13 protein structure - HPA029125 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and tonsil tissues using HPA029125 antibody. Corresponding HSD17B13 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows moderate positivity in leydig cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate to strong granular cytoplasmic positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows moderate granular cytoplasmic positivity in basal epidermal cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no positivity in lymphoid cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human placenta shows no positivity in trophoblastic cells as expected.
Sample type: HUMAN