WH0056953M2

NT5M antibody from MilliporeSigma / Merck KGaA
dNT-2, dNT2, mdN
ELISA
Recommended by provider

Antibody data

Product number
WH0056953M2
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0056953M2, RRID:AB_1842748
Product name
Monoclonal Anti-NT5M antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0056953M2
Antibody type
Monoclonal
Antigen
NT5M (AAH35838, a.a. 129-228) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
CTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTR
DKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACH
NQHLQLQPPRRRLHSWADDWKAILDSKRPC (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -