HPA060121

antibody from Atlas Antibodies

Targeting: BPIFB2 BPIL1, C20orf184, dJ726C3.2, LPLUNC2

Antibody data

Submit

Validation data

Product number: HPA060121 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA060121, RRID:AB_2684207
Product name: Anti-BPIFB2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: FVLPRHVGTEGSMATVGLSQQLFDSALLLLQKAGA LNLDITGQLRSDDNLLNTSALGRLIPEVARQFPEP
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

BPIFB2 protein structure - HPA060121 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human salivary gland and liver tissues using Anti-BPIFB2 antibody. Corresponding BPIFB2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, kidney, liver and salivary gland using Anti-BPIFB2 antibody HPA060121 (A) shows similar protein distribution across tissues to independent antibody HPA049491 (B).
Antibody #2 product nr: HPA049491
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human salivary gland shows strong cytoplasmic positivity in subset of glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human salivary gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-BPIFB2 antibody HPA060121.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-BPIFB2 antibody HPA060121.
Sample type: HUMAN