H00115350-A01

FCRL1 antibody from Abnova Corporation
CD307a, FCRH1, IFGP1, IRTA5

Antibody data

Product number
H00115350-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00115350-A01, RRID:AB_1016784
Product name
FCRL1 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00115350-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant FCRL1.
Antigen sequence
ASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRD
TRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMA
SKVLRSRRSQINVHRVPVADVSLET
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -