H00010850-D01P
antibody from Abnova Corporation
Targeting: CCL27
ALP, CTACK, CTAK, ESkine, ILC, PESKY, SCYA27, skinkine
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010850-D01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010850-D01P, RRID:AB_1572235
- Product name
- CCL27 purified MaxPab rabbit polyclonal antibody (D01P)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human CCL27 protein.
- Antigen sequence
MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCT
QLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLH
LAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNF
GMLRKMG- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CCL27 expression in transfected 293T cell line (H00010850-T01) by CCL27 MaxPab polyclonal antibody.Lane 1: CCL27 transfected lysate(12.60 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to CCL27 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol