SAB2101030

HERC5 antibody from MilliporeSigma / Merck KGaA
CEB1
No application information provided.

Antibody data

Product number
SAB2101030
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2101030, RRID:AB_10610294
Product name
Anti-HERC5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2101030
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_057407.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHPEELKDVIVGNTDYDWKTFEKNARYEPGYNSSH
PTIVMFWKAFHKLTL
Storage
-20C
Provider Type Product Number
- No reagents -