ABIN405711

antibody from antibodies-online

Targeting: AREL1 FIEL1, KIAA0317

Western blot (Data presented on provider website)

Antibody Data

Product number

ABIN405711

Provider

antibodies-online

Product name

anti-KIAA0317 (KIAA0317) antibody

Antibody type

Polyclonal

Antigen

The immunogen for anti-KIAA0317 antibody: synthetic peptide directed towards the middle region of human KIAA0317

Reactivity

Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus

Host

Rabbit

Antigen sequence

VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKV
CFILN NDMSEMELVF


Vial size

50 µg

References

Submitted references

The DNA sequence and analysis of human chromosome 14.

Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Brüls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Ségurens B, Anière F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Ménard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufossé-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guérin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quétier F, Waterston R, Hood L, Weissenbach J
Nature 2003 Feb 6;421(6923):601-7