Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503073 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Porcupine Homolog (Drosophila) (PORCN) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PORCN antibody: synthetic peptide directed towards the N terminal of human PORCN
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
ACRLLWRLGLPSYLKHASTVAGGFFSLYHFFQLHM
VWVVL LSLLCYLVLF- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Suppression of PPN/MG61 attenuates Wnt/beta-catenin signaling pathway and induces apoptosis in human lung cancer.
Chen Z, Li J, Li QS, Fan JQ, Dong XM, Xu JP, Wang XM, Yang GW, Yan P, Wen GZ, Zhang YT, Niu RG, Nan PH, He J, Zhou HM
Oncogene 2008 May 29;27(24):3483-8
Oncogene 2008 May 29;27(24):3483-8
No comments: Submit comment
No validations: Submit validation data