Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005935-M06 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005935-M06, RRID:AB_1712727
- Product name
- RBM3 monoclonal antibody (M06), clone 4D6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RBM3.
- Antigen sequence
MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEV
VVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGE
SLDGRQIRVD- Isotype
- IgG
- Antibody clone number
- 4D6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Differential expression of the RNA-binding motif protein 3 in human astrocytoma.
Zhang HT, Zhang ZW, Xue JH, Kong HB, Liu AJ, Li SC, Liu YX, Xu DG
Chinese medical journal 2013;126(10):1948-52
Chinese medical journal 2013;126(10):1948-52
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RBM3 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RBM3 on HeLa cell . [antibody concentration 40 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RBM3 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol