PAB24173
antibody from Abnova Corporation
Targeting: CHMP4B
C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB24173 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB24173, RRID:AB_11126327
- Product name
- CHMP4B polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human CHMP4B.
- Description
- Rabbit polyclonal antibody raised against recombinant CHMP4B.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEML
SKK- Isotype
- IgG
- Vial size
- 100 μL
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
No validations: Submit validation data