Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008085-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008085-M01, RRID:AB_10662120
- Product name
- MLL2 monoclonal antibody (M01), clone 2E1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MLL2.
- Antigen sequence
SKLEGMFPAYLQEAFFGKELLDLSRKALFAVGVGR
PSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIAD
EESRGLEGKADTPGPEDGGVKASPVPSDPE- Isotype
- IgG
- Antibody clone number
- 2E1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Molecular analysis, pathogenic mechanisms, and readthrough therapy on a large cohort of Kabuki syndrome patients.
Micale L, Augello B, Maffeo C, Selicorni A, Zucchetti F, Fusco C, De Nittis P, Pellico MT, Mandriani B, Fischetto R, Boccone L, Silengo M, Biamino E, Perria C, Sotgiu S, Serra G, Lapi E, Neri M, Ferlini A, Cavaliere ML, Chiurazzi P, Monica MD, Scarano G, Faravelli F, Ferrari P, Mazzanti L, Pilotta A, Patricelli MG, Bedeschi MF, Benedicenti F, Prontera P, Toschi B, Salviati L, Melis D, Di Battista E, Vancini A, Garavelli L, Zelante L, Merla G
Human mutation 2014 Jul;35(7):841-50
Human mutation 2014 Jul;35(7):841-50
No comments: Submit comment
No validations: Submit validation data