HPA014157

antibody from Atlas Antibodies

Targeting: TMX3 FLJ20793, KIAA1830, PDIA13, TXNDC10

Antibody data

Submit

Validation data

Product number: HPA014157 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA014157, RRID:AB_1858469
Product name: Anti-TMX3
Antibody type: Polyclonal
Reactivity: Human, Mouse, Rat
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYA PWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDAT SYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKD DIIEFAHRVSGALIRPLPSQQMF
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

TMX3 protein structure - HPA014157 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Western blot analysis in human cell lines U-251MG and MCF-7 using Anti-TMX3 antibody. Corresponding TMX3 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Western blot analysis in human cell line U-251 MG and human cell line MCF-7.
Orthogonal method: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Supportive validation