SAB2101474

CCDC151 antibody from MilliporeSigma / Merck KGaA
MGC20983
No application information provided.

Antibody data

Product number
SAB2101474
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB2101474, RRID:AB_2072058
Product name
Anti-MGC20983 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2101474
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_659482.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQ
KLIESHKKHRRSRRS
Storage
-20C
Provider Type Product Number
- No reagents -