Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051735-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051735-M01, RRID:AB_489925
- Product name
- RAPGEF6 monoclonal antibody (M01), clone 2C5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAPGEF6.
- Antigen sequence
LFPVVKKDMTFLHEGNDSKVDGLVNFEKLRMISKE
IRQVVRMTSANMDPAMMFRQRSLSQGSTNSNMLDV
QGGAHKKRARRSSLLNAKKLYEDAQMARK- Isotype
- IgG
- Antibody clone number
- 2C5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Critical function of RA-GEF-2/Rapgef6, a guanine nucleotide exchange factor for Rap1, in mouse spermatogenesis.
Okada K, Miyake H, Yamaguchi K, Chiba K, Maeta K, Bilasy SE, Edamatsu H, Kataoka T, Fujisawa M
Biochemical and biophysical research communications 2014 Feb 28;445(1):89-94
Biochemical and biophysical research communications 2014 Feb 28;445(1):89-94
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RAPGEF6 monoclonal antibody (M01), clone 2C5 Western Blot analysis of RAPGEF6 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RAPGEF6 on HeLa cell. [antibody concentration 40 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RAPGEF6 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol