HPA048951

MYO3A antibody from Atlas Antibodies
DFNB30
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA048951
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA048951, RRID:AB_2680567
Product name
Anti-MYO3A
Provider product page
Atlas Antibodies - HPA048951
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IIIQSAARGHLVRKQRKEIVDMKNTAVTTIQTSDQ
EFDYKKNFENTRESFVKKQAENAISANERFISAPN
NKGSVSVVKTSTFKPEEETTNAV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -