HPA038485

antibody from Atlas Antibodies

Targeting: PDHX DLDBP, E3BP, OPDX, PDX1, proX

Antibody data

Submit

Validation data

Product number: HPA038485 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA038485, RRID:AB_10669540
Product name: Anti-PDHX
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: PAARNILEKHSLDASQGTATGPRGIFTKEDALKLV QLKQTGKITESRPTPAPTATPTAPSPLQATAGPSY PRPVIPPVSTPGQPNAVGTFTEI
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PDHX protein structure - HPA038485 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-PDHX antibody. Corresponding PDHX RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, heart muscle, kidney and pancreas using Anti-PDHX antibody HPA038485 (A) shows similar protein distribution across tissues to independent antibody HPA038484 (B).
Antibody #2 product nr: HPA038484
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-PDHX antibody HPA038485.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-PDHX antibody HPA038485.
Sample type: HUMAN