Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010968 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010968, RRID:AB_1845714
- Product name
- Anti-MFF
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RFQAPISAPEYTVTPSPQQARVCPPHMLPEDGANL
SSARGILSLIQSSTRRAYQQILDVLDENRRPVLRG
GSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVV
DAASLRRQIIKLNRRLQLLEEENKERAKR- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references CDK5-dependent inhibitory phosphorylation of Drp1 during neuronal maturation.
A Bcl-xL-Drp1 complex regulates synaptic vesicle membrane dynamics during endocytosis.
Cho B, Cho HM, Kim HJ, Jeong J, Park SK, Hwang EM, Park JY, Kim WR, Kim H, Sun W
Experimental & molecular medicine 2014 Jul 11;46(7):e105
Experimental & molecular medicine 2014 Jul 11;46(7):e105
A Bcl-xL-Drp1 complex regulates synaptic vesicle membrane dynamics during endocytosis.
Li H, Alavian KN, Lazrove E, Mehta N, Jones A, Zhang P, Licznerski P, Graham M, Uo T, Guo J, Rahner C, Duman RS, Morrison RS, Jonas EA
Nature cell biology 2013 Jul;15(7):773-85
Nature cell biology 2013 Jul;15(7):773-85
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gallbladder shows weak cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN