Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010368-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010368-M01, RRID:AB_529976
- Product name
- CACNG3 monoclonal antibody (M01), clone 3E4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CACNG3.
- Antigen sequence
IYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRR
RSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLS
RDPSKITMGTLLNSDRDHAFLQFHNSTPK- Isotype
- IgG
- Antibody clone number
- 3E4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CACNG3 expression in transfected 293T cell line by CACNG3 monoclonal antibody (M01), clone 3E4.Lane 1: CACNG3 transfected lysate(35.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CACNG3 monoclonal antibody (M01), clone 3E4. Western Blot analysis of CACNG3 expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CACNG3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol