HPA041805

DIS3L antibody from Atlas Antibodies
DIS3L1, FLJ38088, KIAA1955, MGC4562
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA041805
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041805, RRID:AB_10796783
Product name
Anti-DIS3L
Provider product page
Atlas Antibodies - HPA041805
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LRNLLKDARHDCILFANEFQQCCYLPRERGESMEK
WQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAIQQ
YGSETEGVFVITFKNYLDNFWPDLKAAHE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -