H00115752-B01P

DIS3L antibody from Abnova Corporation
DIS3L1, FLJ38088, KIAA1955, MGC4562

Antibody data

Product number
H00115752-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00115752-B01P, RRID:AB_1678056
Product name
MGC4562 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00115752-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MGC4562 protein.
Antigen sequence
MQTACQAVQHQRGRRQYNKLRNLLKDARHDCILFA
NEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHH
CQDRMPIVMVTEDEEAIQQYGSETEGVFVITFKNY
LDNFWPDLKAAHELCDSILQSRRERENESQESHGK
EYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIE
AFVRLQGASSKDSDLVSDILIHGMKARNRSIHGDV
VVVELLPKNEWKGRTVALCENDCDDKASGESPSEP
MPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQ
KILVTPWDYRIPKIRISTQQAETLQDFRVVVRIDS
WESTSVYPNGHFVRVLGRIGDLEGEIATILVENSI
SVIPFSEAQMCEMPVNTPESPWKVSPEEEQKRKDL
RKSHLVFSIDPKGCEDVDDTLSVRTLNNGNLELGV
HIADVTHFVAPNSYIDIEARTRATTYYLADRRYDM
LPSVLSADLCSLLGGVDRYAVSIMWELDKASYEIK
KVWYGRTIIRSAYKLFYEAAQELLDGNLSVVDDIP
EFKDLDEKSRQAKLEELVWAIGKLTDIARHVRAKR
DGCGALELEGVEVCVQLDDKKNIHDLIPKQPLEVH
ETVAECMILANHWVAKKIWESFPHQALLRQHPPPH
QEFFSELRECAKAKGFFIDTRSNKTLADSLDNAND
PHDPIVNRLLRSMATQAMSNALYFSTGSCAEEEFH
HYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKD
KKMEIKGNLFSNKDLEELCRHINNRNQAAQHSQKQ
STELFQCMYFKDKDPATEERCISDGVIYSIRTNGV
LLFIPRFGIKGAAYLKNKDGLVISCGPDSCSEWKP
GSLQRFQNKITSTTTDGESVTFHLFDHVTVRISIQ
ASRCHSDTIRLEIISNKPYKIPNTELIHQSSPLLK
SELVKEVTKSVEEAQLAQEVKVNIIQEEYQEYRQT
KGRSLYTLLEEIRDLALLDVSNNYGI
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -