Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000439-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000439-M03, RRID:AB_529969
- Product name
- ASNA1 monoclonal antibody (M03), clone 2H3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ASNA1.
- Antigen sequence
PEQTTFICVCIAEFLSLYETERLIQELAKCKIDTH
NIIVNQLVFPDPEKPCKMCEARHKIQAKYLDQMED
LYEDFHIVKLPLLPHEVRGADKVNTFSALLLEPYK
PPSAQ- Isotype
- IgG
- Antibody clone number
- 2H3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A precursor-specific role for Hsp40/Hsc70 during tail-anchored protein integration at the endoplasmic reticulum.
Rabu C, Wipf P, Brodsky JL, High S
The Journal of biological chemistry 2008 Oct 10;283(41):27504-13
The Journal of biological chemistry 2008 Oct 10;283(41):27504-13
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ASNA1 expression in transfected 293T cell line by ASNA1 monoclonal antibody (M03), clone 2H3.Lane 1: ASNA1 transfected lysate(38.8 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- ASNA1 monoclonal antibody (M03), clone 2H3. Western Blot analysis of ASNA1 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ASNA1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to ASNA1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ASNA1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 0.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
