Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA011008 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA011008, RRID:AB_1079011
- Product name
- Anti-GOLGB1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KHDNQTNVTEEGTQSIPGETEEQDSLSMSTRPTCS
ESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKE
RIAGLEEEKQKNKEFSQTLENEKNTLLSQISTKDG
ELKMLQEEVTKMNLLNQQIQEELS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The specificity of vesicle traffic to the Golgi is encoded in the golgin coiled-coil proteins
Arl8 and SKIP act together to link lysosomes to kinesin-1.
Wong M, Munro S
Science 2014 October;346(6209):1256898-1256898
Science 2014 October;346(6209):1256898-1256898
Arl8 and SKIP act together to link lysosomes to kinesin-1.
Rosa-Ferreira C, Munro S
Developmental cell 2011 Dec 13;21(6):1171-8
Developmental cell 2011 Dec 13;21(6):1171-8
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex, colon, epididymis and kidney using Anti-GOLGB1 antibody HPA011008 (A) shows similar protein distribution across tissues to independent antibody HPA011555 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human epididymis using Anti-GOLGB1 antibody HPA011008.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex using Anti-GOLGB1 antibody HPA011008.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon using Anti-GOLGB1 antibody HPA011008.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-GOLGB1 antibody HPA011008.
- Sample type
- HUMAN