Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00025805-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00025805-M01, RRID:AB_425916
- Product name
- BAMBI monoclonal antibody (M01), clone 3C1-1D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant BAMBI.
- Antigen sequence
MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAA
HCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCL
DSLASTTDICQAKQARNHSGTTIPTLECCHEDMCN
YRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQ
ELTSSKELWFRAAVIAVPIAGGLTLVLLIMLALRM
LRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAK
LDLECMVPVSGHENCCLTCDKMRQADLSNDKILSL
VHWGMYSGHGKLEFV- Isotype
- IgG
- Antibody clone number
- 3C1-1D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Adiponectin induces the transforming growth factor decoy receptor BAMBI in human hepatocytes.
BAMBI is expressed in endothelial cells and is regulated by lysosomal/autolysosomal degradation.
BAMBI is overexpressed in ovarian cancer and co-translocates with Smads into the nucleus upon TGF-beta treatment.
BAMBI (bone morphogenetic protein and activin membrane-bound inhibitor) reveals the involvement of the transforming growth factor-beta family in pain modulation.
Wanninger J, Neumeier M, Bauer S, Weiss TS, Eisinger K, Walter R, Dorn C, Hellerbrand C, Schäffler A, Buechler C
FEBS letters 2011 May 6;585(9):1338-44
FEBS letters 2011 May 6;585(9):1338-44
BAMBI is expressed in endothelial cells and is regulated by lysosomal/autolysosomal degradation.
Xavier S, Gilbert V, Rastaldi MP, Krick S, Kollins D, Reddy A, Bottinger E, Cohen CD, Schlondorff D
PloS one 2010 Sep 24;5(9):e12995
PloS one 2010 Sep 24;5(9):e12995
BAMBI is overexpressed in ovarian cancer and co-translocates with Smads into the nucleus upon TGF-beta treatment.
Pils D, Wittinger M, Petz M, Gugerell A, Gregor W, Alfanz A, Horvat R, Braicu EI, Sehouli J, Zeillinger R, Mikulits W, Krainer M
Gynecologic oncology 2010 May;117(2):189-97
Gynecologic oncology 2010 May;117(2):189-97
BAMBI (bone morphogenetic protein and activin membrane-bound inhibitor) reveals the involvement of the transforming growth factor-beta family in pain modulation.
Tramullas M, Lantero A, Díaz A, Morchón N, Merino D, Villar A, Buscher D, Merino R, Hurlé JM, Izpisúa-Belmonte JC, Hurlé MA
The Journal of neuroscience : the official journal of the Society for Neuroscience 2010 Jan 27;30(4):1502-11
The Journal of neuroscience : the official journal of the Society for Neuroscience 2010 Jan 27;30(4):1502-11
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BAMBI expression in transfected 293T cell line by BAMBI monoclonal antibody (M01), clone 3C1-1D1.Lane 1: BAMBI transfected lysate(29.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BAMBI is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
