Antibody data

Product number
R31782
Provider
NSJ Bioreagents
Product name
Galectin 9 Antibody
Provider product page
NSJ Bioreagents - R31782
Antibody type
Polyclonal
Antigen
Amino acids DGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT of human Galectin 9 were used as the immunogen for the Galectin 9 antibody.
Description
Antigen affinity
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Vial size
100 µg
Concentration
Lyophilized; resuspend with 200 ul for 0.5 mg/ml
Storage
After reconstitution, the Galectin 9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -