SAB2101339

LGALS9 antibody from Sigma-Aldrich
LGALS9A
No application information provided.

Antibody data

Product number
SAB2101339
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2101339, RRID:AB_10604791
Product name
Anti-LGALS9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2101339
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_033665.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPS
AQRFHINLCSGNHIA
Storage
-20C
Provider Type Product Number
- No reagents -