Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005986-M08 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005986-M08, RRID:AB_566130
- Product name
- RFNG monoclonal antibody (M08), clone 6C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RFNG.
- Antigen sequence
LGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSP
LFHSHLENLQRLPPDTLLQQVTLSHGGPENPQNVV
NVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQG
APTS- Isotype
- IgG
- Antibody clone number
- 6C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RFNG monoclonal antibody (M08), clone 6C7 Western Blot analysis of RFNG expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RFNG on HepG2 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol