Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007260-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007260-M01, RRID:AB_566256
- Product name
- TSSC1 monoclonal antibody (M01), clone 2H5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TSSC1.
- Antigen sequence
VLTGSSDSRVILSNMVSISSEPFGHLVDDDDISDQ
EDHRSEEKSKEPLQDNVIATYEEHEDSVYAVDWSS
ADPWLFASLSYDGRLVINRVPRALKYHILL- Isotype
- IgG
- Antibody clone number
- 2H5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TSSC1 monoclonal antibody (M01), clone 2H5 Western Blot analysis of TSSC1 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TSSC1 expression in transfected 293T cell line by TSSC1 monoclonal antibody (M01), clone 2H5.Lane 1: TSSC1 transfected lysate (Predicted MW: 43.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TSSC1 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to TSSC1 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
