Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109444 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transcription Factor CP2 (TFCP2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-UBP1 antibody: synthetic peptide directed towards the middle region of human UBP1
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
GASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLF
SNFSGADLLKLTKED- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Cloning of factors related to HIV-inducible LBP proteins that regulate steroidogenic factor-1-independent human placental transcription of the cholesterol side-chain cleavage enzyme, P450scc.
Huang N, Miller WL
The Journal of biological chemistry 2000 Jan 28;275(4):2852-8
The Journal of biological chemistry 2000 Jan 28;275(4):2852-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human Daudi; WB Suggested Anti-UBP1 Antibody Titration: 0.2-1 ug/ml. Positive Control: Daudi cell lysate. UBP1 is supported by BioGPS gene expression data to be expressed in Daudi.; UBP1 antibody - middle region (AP42208PU-N) in Human Daudi cells using Western Blot