HPA029058

NT5C3A antibody from Atlas Antibodies
cN-III, hUMP1, NT5C3, p36, P5'N-1, PN-I, POMP, PSN1, UMPH, UMPH1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA029058
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA029058, RRID:AB_10601380
Product name
Anti-NT5C3A
Provider product page
Atlas Antibodies - HPA029058
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSR
FSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEK
YYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQAL
PKAKLKEIVAESDVMLKEGY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -