HPA037734

antibody from Atlas Antibodies

Targeting: MYOT LGMD1, LGMD1A, TTID

Antibody data

Submit

Validation data

Product number: HPA037734 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA037734, RRID:AB_2675638
Product name: Anti-MYOT
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ACVAKNRAGEATFTVQLDVLAKEHKRAPMFIYKPQ SKKVLEGDSVKLECQISAIPPPKLFWKRNNEMVQF NTDRISLYQDNTGRVTLLIKDVNKKDAG
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MYOT protein structure - HPA037734 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-MYOT antibody. Corresponding MYOT RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, lymph node, skeletal muscle and testis using Anti-MYOT antibody HPA037734 (A) shows similar protein distribution across tissues to independent antibody HPA037733 (B).
Antibody #2 product nr: HPA037733
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skeletal muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human skin shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-MYOT antibody HPA037734.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-MYOT antibody HPA037734.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis using Anti-MYOT antibody HPA037734.
Sample type: HUMAN