WH0060436M1

TGIF2 antibody from MilliporeSigma / Merck KGaA
ELISA
Recommended by provider

Antibody data

Product number
WH0060436M1
Provider
MilliporeSigma / Merck KGaA
Product name
Monoclonal Anti-TGIF2 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0060436M1
Antibody type
Monoclonal
Antigen
TGIF2 (NP_068581, a.a. 131-237) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
SMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLT
LLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQL
LVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSEN
P* (without GST)
Isotype
IgG
Storage
-20C