Antibody data

Product number
H00060436-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00060436-D01P, RRID:AB_1715719
Product name
TGIF2 purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00060436-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human TGIF2 protein.
Antigen sequence
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRD
WLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFI
NARRRLLPDMLRKDGKDPNQFTISRRGGKASDVAL
PRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGE
KPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSP
TGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAA
EMELQKQQDPSLPLLHTPIPLVSENPQ
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.