Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00164668-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00164668-B01P, RRID:AB_10558294
- Product name
- APOBEC3H purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human APOBEC3H protein.
- Antigen sequence
MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLT
PQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDE
TQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLG
IFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPE
FADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKR
RLERIKS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of APOBEC3H expression in transfected 293T cell line (H00164668-T02) by APOBEC3H MaxPab polyclonal antibody.Lane 1: RP4-742C19.3 transfected lysate(20.02 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RP4-742C19.3 MaxPab polyclonal antibody. Western Blot analysis of RP4-742C19.3 expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of purified MaxPab antibody to APOBEC3H on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol