HPA015998

antibody from Atlas Antibodies

Targeting: ASGR2 CLEC4H2

Antibody data

Submit

Validation data

Product number: HPA015998 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA015998, RRID:AB_1845084
Product name: Anti-ASGR2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGR WNDDFCLQVYRWVCEKR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ASGR2 protein structure - HPA015998 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human liver and pancreas tissues using Anti-ASGR2 antibody. Corresponding ASGR2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human colon, liver, lymph node and pancreas using Anti-ASGR2 antibody HPA015998 (A) shows similar protein distribution across tissues to independent antibody HPA014899 (B).
Antibody #2 product nr: HPA014899
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-ASGR2 antibody HPA015998.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-ASGR2 antibody HPA015998.
Sample type: HUMAN