HPA035763

antibody from Atlas Antibodies

Targeting: MYOZ2 C4orf5, CS-1, FATZ-2

Antibody data

Submit

Validation data

Product number: HPA035763 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA035763, RRID:AB_2674770
Product name: Anti-MYOZ2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: VATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSF VNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTT VPESED
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

MYOZ2 protein structure - HPA035763 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human heart muscle and prostate tissues using Anti-MYOZ2 antibody. Corresponding MYOZ2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human heart muscle, kidney, liver and prostate using Anti-MYOZ2 antibody HPA035763 (A) shows similar protein distribution across tissues to independent antibody HPA035764 (B).
Antibody #2 product nr: HPA035764
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human heart muscle shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-MYOZ2 antibody HPA035763.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-MYOZ2 antibody HPA035763.
Sample type: HUMAN