Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009467-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009467-M01, RRID:AB_607018
- Product name
- SH3BP5 monoclonal antibody (M01), clone 2B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SH3BP5.
- Antigen sequence
GLEEEEEVDPRIQGELEKLNQSTDDINRRETELED
ARQKFRSVLVEATVKLDELVKKIGKAVEDSKPYWE
ARRVARQAQLEAQKATQDFQRATEVLRAAKETISL
AEQR- Isotype
- IgG
- Antibody clone number
- 2B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references JNK interaction with Sab mediates ER stress induced inhibition of mitochondrial respiration and cell death.
Win S, Than TA, Fernandez-Checa JC, Kaplowitz N
Cell death & disease 2014 Jan 9;5:e989
Cell death & disease 2014 Jan 9;5:e989
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SH3BP5 monoclonal antibody (M01), clone 2B3 Western Blot analysis of SH3BP5 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SH3BP5 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to SH3BP5 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SH3BP5 on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
