Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00128434-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00128434-M01, RRID:AB_463779
- Product name
- C20orf102 monoclonal antibody (M01), clone 3B9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant C20orf102.
- Antigen sequence
TRPAGHAPWDNHVSGHALFTETPHDMTARTGEDVE
MACSFRGSGSPSYSLEIQWWYVRSHRDWTDKQAWA
SNQLKASQQEDAGKEATKISVVKVVGSNISHKLRL
SRVKPTDEGSYECRVIDFSDGKARHHKVKAYLRVQ
PGENSVLHLPEAPPAAPAPPPPKPGKELRKRSVDQ
EACSL- Isotype
- IgG
- Antibody clone number
- 3B9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- C20orf102 monoclonal antibody (M01), clone 3B9 Western Blot analysis of C20orf102 expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of C20orf102 expression in transfected 293T cell line by C20orf102 monoclonal antibody (M01), clone 3B9.Lane 1: C20orf102 transfected lysate(22 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged VSTM2L is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol