WH0002395M3

FXN antibody from Sigma-Aldrich
CyaY, FA, FARR, FRDA, X25
ELISA
Recommended by provider

Antibody data

Product number
WH0002395M3
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0002395M3, RRID:AB_1841680
Product name
Monoclonal Anti-FXN antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0002395M3
Antibody type
Monoclonal
Antigen
FXN (NP_000135, a.a. 91-201) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDV
SFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPS
SGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALK
TKLDL* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -