HPA068304

FXN antibody from Atlas Antibodies
CyaY, FA, FARR, FRDA, X25

Antibody data

Product number
HPA068304
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA068304, RRID:AB_2685970
Product name
Anti-FXN
Provider product page
Atlas Antibodies - HPA068304
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMN
LRKSGTLGHPGSLDETTYERLAEETLDSLAEFFED
LADKPYTFEDYDV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -