H00002395-D01

FXN antibody from Abnova Corporation
CyaY, FA, FARR, FRDA, X25

Antibody data

Product number
H00002395-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00002395-D01, RRID:AB_10718620
Product name
FXN MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00002395-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human FXN protein.
Antigen sequence
MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAP
LCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKK
QSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDS
LAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDL
GTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVY
SHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -