Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005813-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005813-M01, RRID:AB_1112080
- Product name
- PURA monoclonal antibody (M01), clone 3F10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PURA.
- Antigen sequence
TQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAE
LPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPT
YRNSITVPYKVWAKFGHTFCKYSEETKKIQEKQRE
KRAAC- Isotype
- IgG
- Antibody clone number
- 3F10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PURA monoclonal antibody (M01), clone 3F10. Western Blot analysis of PURA expression in human skeletal muscle.
- Protocol
- Protocol
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PURA monoclonal antibody (M01), clone 3F10. Western Blot analysis of PURA expression in rat brain.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PURA is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PURA on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol