Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010252-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010252-M01, RRID:AB_490033
- Product name
- SPRY1 monoclonal antibody (M01), clone 3H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SPRY1.
- Antigen sequence
MDPQNQHGSGSSLVVIQQPSLDSRQRLDYEREIQP
TAILSLDQIKAIRGSNEYTEGPSVVKRPAPRTAPR
QEKHERTHEIIPINVNNNYEHRHTSHLGHAVLPSN
ARGPI- Isotype
- IgG
- Antibody clone number
- 3H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Human Sprouty1 suppresses growth, migration, and invasion in human breast cancer cells.
Initial report on differential expression of sprouty proteins 1 and 2 in human epithelial ovarian cancer cell lines.
Mekkawy AH, Pourgholami MH, Morris DL
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2014 May;35(5):5037-48
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine 2014 May;35(5):5037-48
Initial report on differential expression of sprouty proteins 1 and 2 in human epithelial ovarian cancer cell lines.
Moghaddam SM, Amini A, Wei AQ, Pourgholami MH, Morris DL
Journal of oncology 2012;2012:373826
Journal of oncology 2012;2012:373826
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SPRY1 monoclonal antibody (M01), clone 3H4 Western Blot analysis of SPRY1 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of SPRY1 expression in transfected 293T cell line by SPRY1 monoclonal antibody (M01), clone 3H4.Lane 1: SPRY1 transfected lysate(35.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged SPRY1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to SPRY1 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
